Structure of PDB 8evp Chain BF

Receptor sequence

>8evpBF (length=206) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

FTPVVLATPIPEEVQQAQTEIKLFNKWSFEEVEVKDASLVDYVQVRQPIF
VAHTAGRYANKRFRKAQCPIIERLTNSLMMNGRNNGKKLKAVRIIKHTLD
IINVLTDQNPIQVVVDAITNTGPREDTTRVGGGGAARRQAVDVSPLRRVN
QAIALLTIGAREAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELER
VAKSNR

3D structure

PDB

8evp Regulation of translation by ribosomal RNA pseudouridylation.

Chain

Resolution

2.38 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BF	H72 A78 K80 R81 K84 N95 L97 M99 N100 G101 R102 N103 N104 K106 K107 K109 R112 G151 R166 N169 R180 F184 R185 N186 I187 T189 I190	H53 A59 K61 R62 K65 N76 L78 M80 N81 G82 R83 N84 N85 K87 K88 K90 R93 G132 R147 N150 R161 F165 R166 N167 I168 T170 I171
BS02	rna	BF	E216 R219 V220 S223	E197 R200 V201 S204

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8evp, PDBe:8evp, PDBj:8evp
PDBsum	8evp
PubMed	37595043
UniProt	A0A1L4AA68

[Back to BioLiP]