Structure of PDB 8bqx Chain BF

Receptor sequence

>8bqxBF (length=188) Species: 4932 (Saccharomyces cerevisiae)

ANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIV
KKAVTVHSKSRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRV
LRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQR
EKALNEEAEARRLKNRAARDRRAQRVAEKRDALLKEDA

3D structure

• PDB: 8bqx The dynamic architecture of Map1- and NatB-ribosome complexes coordinates the sequential modifications of nascent polypeptide chains.
• Chain: BF
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BF	R162 R163 K165 R173 R176	R161 R162 K164 R172 R175
BS02	rna	BF	A2 N3 L4 R5 T6 K8 R9 G18 K19 R20 K21 W23 L24 R38 N39 R42 K43 K46 T56 H58 S59 K60 S61 R62 R64 R74 H75 G77 Y78 G79 R81 K82 G83 T84 R85 A87 R88 Q92 V93 W95 I96 R97 R100 V101 R103 R104 R110 H118 Y120 H121 Y124 K125 K128 G129 H134 K135 R136	A1 N2 L3 R4 T5 K7 R8 G17 K18 R19 K20 W22 L23 R37 N38 R41 K42 K45 T55 H57 S58 K59 S60 R61 R63 R73 H74 G76 Y77 G78 R80 K81 G82 T83 R84 A86 R87 Q91 V92 W94 I95 R96 R99 V100 R102 R103 R109 H117 Y119 H120 Y123 K124 K127 G128 H133 K134 R135

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8bqx, PDBe:8bqx, PDBj:8bqx
• PDBsum: 8bqx
• PubMed: 37079644
• UniProt: P0CX82|RL19A_YEAST Large ribosomal subunit protein eL19A (Gene Name=RPL19A)