Structure of PDB 4v9j Chain BF

Receptor sequence

>4v9jBF (length=208) Species: 262724 (Thermus thermophilus HB27)

MKEVAVYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTAS
TKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYT
LPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDG
SESVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWE
VFQNRIGG

3D structure

• PDB: 4v9j Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
• Chain: BF
• Resolution: 3.86 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BF	H31 L32 W34 R38 L41 K43 R44 R45 R46 T48 S50 T51 K52 R54 V57 Y59 S60 R62 Q67 K68 H69 G71 R72 R74 H75 I82 F83 V84 G85 V88 V89 F90 P92 P94 R95 Y99 T100 P102 K103 K104 R106 K107 K108 G134 K135 T136 K137 R165 R168 N169 L170 P171 E179 G180 N182 Y184 R205	H31 L32 W34 R38 L41 K43 R44 R45 R46 T48 S50 T51 K52 R54 V57 Y59 S60 R62 Q67 K68 H69 G71 R72 R74 H75 I82 F83 V84 G85 V88 V89 F90 P92 P94 R95 Y99 T100 P102 K103 K104 R106 K107 K108 G134 K135 T136 K137 R165 R168 N169 L170 P171 E179 G180 N182 Y184 R205

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v9j, PDBe:4v9j, PDBj:4v9j
• PDBsum: 4v9j
• PubMed: 23812722
• UniProt: Q72I05|RL4_THET2 Large ribosomal subunit protein uL4 (Gene Name=rplD)