Structure of PDB 4v8k Chain BF

Receptor sequence
>4v8kBF (length=56) Species: 1050 (Thermochromatium tepidum) [Search protein sequence]
MNANLYKIWLILDPRRVLVSIVAFQIVLGLLIHMIVLSTDLNWLDDNIPV
SYQALG
3D structure
PDB4v8k Structure of the LH1-RC complex from Thermochromatium tepidum at 3.0 angstrom
ChainBF
Resolution3.006 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA BF N45 W46 D49 N50 N42 W43 D46 N47
BS02 BCL BF Q28 I29 G32 H36 W46 Q25 I26 G29 H33 W43
BS03 CRT BF L8 K10 I11 L5 K7 I8
BS04 BCL BF Q28 L31 G32 I35 H36 Q25 L28 G29 I32 H33
BS05 CRT BF I24 Q28 L31 I21 Q25 L28
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8k, PDBe:4v8k, PDBj:4v8k
PDBsum4v8k
PubMed24670637
UniProtD2Z0P2

[Back to BioLiP]