Structure of PDB 4v7e Chain BF

Receptor sequence

>4v7eBF (length=191) Species: 4565 (Triticum aestivum)

QVVKLFNCWSFEDVQVNDISLADYLAVSSTKHATYLPHTAGRYSAKRFRK
AQCPLVERLTNSLMMHGRNNGKKIMAVRIVKHAMEIIHLLTDANPIQVIV
DAIINSGPREDATRIGSAGAVRRQAVDISPLRRVNQAIYLLTTGARESAF
RNIKTIAECLADELINAAKGSSNSYAIKKKDEIERVAKANR

3D structure

• PDB: 4v7e Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.
• Chain: BF
• Resolution: 5.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BF	A49 S53 N70 L72 M73 M74 H75 G76 R77 N78 N79 G80 K81 K82 I83 M84 R87 T122 R123 R141 N144 Y148 A158 F159 R160 N161 I162 I165	A40 S44 N61 L63 M64 M65 H66 G67 R68 N69 N70 G71 K72 K73 I74 M75 R78 T113 R114 R132 N135 Y139 A149 F150 R151 N152 I153 I156

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 02:36:01 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v7e', asym_id = 'BF', title = 'Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v7e', asym_id='BF', title='Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0006412,0015935', uniprot = '', pdbid = '4v7e', asym_id = 'BF'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0006412,0015935', uniprot='', pdbid='4v7e', asym_id='BF')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>