Structure of PDB 4v6n Chain BF

Receptor sequence

>4v6nBF (length=232) Species: 562 (Escherichia coli)

GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKAS
VSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQI
NIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKV
EVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVW
IFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK

3D structure

• PDB: 4v6n Structural characterization of mRNA-tRNA translocation intermediates.
• Chain: BF
• Resolution: 12.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BF	G1 Q2 K3 V4 H5 I9 I13 N24 K26 S153 G154 R155 E160 I161 A162 W166 R168 E169 G170 R171 V172 L174 H175 L177 R178 T185 E187 H189 T191 V194 I195 K198 V213 E214 Q215 P216 E217 K218 K225 Q226 Q227 K229 G230 R231 K232	G1 Q2 K3 V4 H5 I9 I13 N24 K26 S153 G154 R155 E160 I161 A162 W166 R168 E169 G170 R171 V172 L174 H175 L177 R178 T185 E187 H189 T191 V194 I195 K198 V213 E214 Q215 P216 E217 K218 K225 Q226 Q227 K229 G230 R231 K232
BS02	rna	BF	M128 R130 I161 A162 R163 E165	M128 R130 I161 A162 R163 E165

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6n, PDBe:4v6n, PDBj:4v6n
• PDBsum: 4v6n
• PubMed: 22467828
• UniProt: P0A7V3|RS3_ECOLI Small ribosomal subunit protein uS3 (Gene Name=rpsC)