Structure of PDB 4v68 Chain BF

Receptor sequence

>4v68BF (length=207) Species: 274 (Thermus thermophilus)

MKEVAVYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTAS
TKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYT
LPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDG
SESVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWE
VFQNRIG

3D structure

• PDB: 4v68 GTPase activation of elongation factor EF-Tu by the ribosome during decoding
• Chain: BF
• Resolution: 6.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BF	H31 L32 E35 R38 Q40 L41 K43 R44 R45 R46 T48 S50 T51 K52 T53 R54 G55 V57 A58 Y59 S60 G61 K63 Q67 K68 H69 G71 R72 A73 R74 H75 G76 I82 F83 V84 V88 F90 P92 R95 Y99 T100 P102 K103 K104 V105 R106 K107 G134 K135 T136 K137 R165 R168 N169 P171 E179 G180 N182 Y184 R205	H31 L32 E35 R38 Q40 L41 K43 R44 R45 R46 T48 S50 T51 K52 T53 R54 G55 V57 A58 Y59 S60 G61 K63 Q67 K68 H69 G71 R72 A73 R74 H75 G76 I82 F83 V84 V88 F90 P92 R95 Y99 T100 P102 K103 K104 V105 R106 K107 G134 K135 T136 K137 R165 R168 N169 P171 E179 G180 N182 Y184 R205

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v68, PDBe:4v68, PDBj:4v68
• PDBsum: 4v68
• PubMed: 19229291
• UniProt: Q5SHN9|RL4_THET8 Large ribosomal subunit protein uL4 (Gene Name=rplD)