Structure of PDB 4v4z Chain BF

Receptor sequence

>4v4zBF (length=208) Species: 300852 (Thermus thermophilus HB8)

EVAVYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTK
TRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLP
KKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSE
SVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVF
QNRIGGEA

3D structure

• PDB: 4v4z Structural basis for messenger RNA movement on the ribosome.
• Chain: BF
• Resolution: 4.51 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BF	H31 L32 E35 Q40 L41 R45 R46 T48 S50 T51 K52 T53 R54 E56 V57 Y59 S60 R62 Q67 K68 H69 T70 R72 R74 H75 G76 D77 P81 I82 F83 V84 G85 V88 V89 F90 K93 P94 R95 Y97 Y99 T100 P102 K103 K104 V105 R106 K107 K108 K135 T136 R164 R165 R168 L170 P171 L176 G180 L181 V187 R188	H29 L30 E33 Q38 L39 R43 R44 T46 S48 T49 K50 T51 R52 E54 V55 Y57 S58 R60 Q65 K66 H67 T68 R70 R72 H73 G74 D75 P79 I80 F81 V82 G83 V86 V87 F88 K91 P92 R93 Y95 Y97 T98 P100 K101 K102 V103 R104 K105 K106 K133 T134 R162 R163 R166 L168 P169 L174 G178 L179 V185 R186

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v4z, PDBe:4v4z, PDBj:4v4z
• PDBsum: 4v4z
• PubMed: 17051149
• UniProt: Q5SHN9|RL4_THET8 Large ribosomal subunit protein uL4 (Gene Name=rplD)