Structure of PDB 4v4x Chain BF

Receptor sequence

>4v4xBF (length=208) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

EVAVYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTK
TRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLP
KKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSE
SVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVF
QNRIGGEA

3D structure

PDB

4v4x Structural basis for messenger RNA movement on the ribosome.

Chain

Resolution

5.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BF	H31 L32 E35 Q40 L41 R45 R46 T48 A49 S50 K52 R54 E56 V57 A58 Y59 S60 R62 K63 Q67 H69 T70 R72 R74 H75 G76 D77 P81 I82 F83 V84 G85 G86 V88 V89 F90 P92 K93 R95 Y97 Y99 T100 P102 K103 K104 V105 R106 K107 K108 K135 T136 K137 R165 R168 N169 L170 P171 G180 L181 N182 V187 R188	H29 L30 E33 Q38 L39 R43 R44 T46 A47 S48 K50 R52 E54 V55 A56 Y57 S58 R60 K61 Q65 H67 T68 R70 R72 H73 G74 D75 P79 I80 F81 V82 G83 G84 V86 V87 F88 P90 K91 R93 Y95 Y97 T98 P100 K101 K102 V103 R104 K105 K106 K133 T134 K135 R163 R166 N167 L168 P169 G178 L179 N180 V185 R186

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v4x, PDBe:4v4x, PDBj:4v4x
PDBsum	4v4x
PubMed	17051149
UniProt	Q5SHN9\|RL4_THET8 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]