Structure of PDB 4v4n Chain BF

Receptor sequence

>4v4nBF (length=217) Species: 2190 (Methanocaldococcus jannaschii)

MSQEWKEYAKRVLDEWEPKTKLGMMVKEGQITDIHEIFRRGYQIKEPEII
DVLLPEVNARENQEVLDIALTVRMTDSGRRVRFRVLAAVGNRDGYVGLGI
GHGKEVGIAIRKAINYAKLNIIEIKRGCGSWECRCRRPHSVPFAVEGKEG
SVRVRLIPGPRGLGLVIGDVGKKILRLAGVQDVWSQTFGETRTTVNFAKA
VFNALYNTNRVAISPEM

3D structure

• PDB: 4v4n Structure of the SecY channel during initiation of protein translocation.
• Chain: BF
• Resolution: 9.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BF	T71 V72 R73 M74 D76 S77 R84 H102 K104 K112 G150 S151 L163 V166 W184 Q186 T187 F188 E190 T191 R192 T193 N196	T71 V72 R73 M74 D76 S77 R84 H102 K104 K112 G150 S151 L163 V166 W184 Q186 T187 F188 E190 T191 R192 T193 N196

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Mar 9 09:20:30 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4n', asym_id = 'BF', title = 'Structure of the SecY channel during initiation of protein translocation.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4n', asym_id='BF', title='Structure of the SecY channel during initiation of protein translocation.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0015935', uniprot = '', pdbid = '4v4n', asym_id = 'BF'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0015935', uniprot='', pdbid='4v4n', asym_id='BF')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>