Structure of PDB 9f1b Chain BE

Receptor sequence

>9f1bBE (length=243) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

PKKGKPHCSRNPVLVRGIGRYSRSAMYSRKALYKRKYAAPKSRIERKKKR
EKVLATVTKPVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQ
HVRKLRASITPGTILIILTGRHRGKRVVFLKQLSSGLLLVTGPLSLNRVP
LRRTHQKFVIATSTKIDISGVKIPKHLTDAYFKKKKLRKPEKEKYEITEQ
RKVDQKAVDSQILPKIKAVPQLQGYLRSVFALTNGVYPHKLVF

3D structure

PDB

9f1b NAC guides a ribosomal multienzyme complex for nascent protein processing.

Chain

Resolution

3.01 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BE	G42 H45 C46 S47 R48 R54 S60 R61 S62 M64 Y65 S66 R67 K68 A69 Y71 K72 R73 Y75 A77 K79 R84 K85 K86 R88 A93 T94 P98 V99 G100 G101 K103 N104 R108 V110 K111 K114 M115 P116 R117 Y118 R126 K127 L128 L129 H131 K133 K134 P135 F136 S137 H139 K142 T157 G158 R159 H160 R161 L175 L182 L184 R186 P188 R190 R191 H193 K195 F196 F220 K222 R226 Y243 I245 R249 K250 K265 Q269 Q271 R275 S276 V277 N282	G4 H7 C8 S9 R10 R16 S22 R23 S24 M26 Y27 S28 R29 K30 A31 Y33 K34 R35 Y37 A39 K41 R46 K47 K48 R50 A55 T56 P60 V61 G62 G63 K65 N66 R70 V72 K73 K76 M77 P78 R79 Y80 R88 K89 L90 L91 H93 K95 K96 P97 F98 S99 H101 K104 T119 G120 R121 H122 R123 L137 L144 L146 R148 P150 R152 R153 H155 K157 F158 F182 K184 R188 Y195 I197 R201 K202 K217 Q221 Q223 R227 S228 V229 N234

External links

PDB	RCSB:9f1b, PDBe:9f1b, PDBj:9f1b
PDBsum	9f1b
PubMed	39169182
UniProt	G1SKF7\|RL6_RABIT Large ribosomal subunit protein eL6 (Gene Name=RPL6)

[Back to BioLiP]