Structure of PDB 8jiw Chain BE

Receptor sequence

>8jiwBE (length=263) Species: 4565 (Triticum aestivum) [Search protein sequence]

ARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNR
LKYALTYREVQSILMQRHIMVDGKVRTDKTYPAGFMDIISIPKTGENYRL
LYDTKGRFRLHSVRDEDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPD
PLIKANDTIKLDLETNKIVDFIKFDVGNVVMVTGGRNTGRVGVIKNREKH
KGTFETIHVEDAQGHQFATRLGNVFTIGKGTKPWVSLPKGKGIKLTIIEE
QRKRDAAAQAAAK

3D structure

PDB

8jiw Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.

Chain

Resolution

2.88 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BE	R3 G4 K7 H8 K10 R11 L12 N13 M19 D21 K22 L23 F27 P29 S33 G34 K37 R49 T57 Y58 Q62 M66 K75 R77 K106 R108 R127 Q130 F131 K134 G135 N140 T146 R148 K155 G186 R187 H201 F205 K240 T247	R2 G3 K6 H7 K9 R10 L11 N12 M18 D20 K21 L22 F26 P28 S32 G33 K36 R48 T56 Y57 Q61 M65 K74 R76 K105 R107 R126 Q129 F130 K133 G134 N139 T145 R147 K154 G185 R186 H200 F204 K239 T246

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8jiw, PDBe:8jiw, PDBj:8jiw
PDBsum	8jiw
PubMed	38458197
UniProt	A0A1D5SLI4

[Back to BioLiP]