Structure of PDB 8fle Chain BE

Receptor sequence
>8fleBE (length=160) Species: 9606 (Homo sapiens) [Search protein sequence]
AKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAARICANKYMVK
SCGKDGFHIRVRLHPFHVIGTVARVHIGQVIMSIRTKLQNKEHVIEALRR
AKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPSRG
PLDKWRALHS
3D structure
PDB8fle Principles of human pre-60S biogenesis
ChainBE
Resolution2.48 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BE D35 R90 H92 F94 D193 G194 K198 D7 R62 H64 F66 D139 G140 K144
BS02 rna BE Y199 S202 R203 G204 P205 L206 W209 Y145 S148 R149 G150 P151 L152 W155
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0045182 translation regulator activity
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0043066 negative regulation of apoptotic process
GO:1990403 embryonic brain development
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005790 smooth endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0032991 protein-containing complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fle, PDBe:8fle, PDBj:8fle
PDBsum8fle
PubMed37410842
UniProtP27635|RL10_HUMAN Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]