Structure of PDB 8evp Chain BE

Receptor sequence

>8evpBE (length=260) Species: 4932 (Saccharomyces cerevisiae)

ARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNR
LKYALNGREVKAILMQRHVKVDGKVRTDTTYPAGFMDVITLDATNENFRL
VYDVKGRFAVHRITDEEASYKLGKVKKVQLGKKGVPYVVTHDGRTIRYPD
PNIKVNDTVKIDLASGKITDFIKFDAGKLVYVTGGRNLGRIGTIVHKERH
DGGFDLVHIKDSLDNTFVTRLNNVFVIGEQGKPYISLPKGKGIKLSIAEE
RDRRRAQQGL

3D structure

• PDB: 8evp Regulation of translation by ribosomal RNA pseudouridylation.
• Chain: BE
• Resolution: 2.38 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BE	R3 P5 K6 K7 H8 K10 L12 H16 L19 D21 K22 L23 Y27 P29 R30 A33 G34 K37 L38 R49 N57 G58 R59 K62 M66 K75 R77 K106 R108 K128 L131 G132 K133 K134 G135 V140 R145 T146 R148 G186 R187 R200 H201 G203 F205 R221 K240 R255	R2 P4 K5 K6 H7 K9 L11 H15 L18 D20 K21 L22 Y26 P28 R29 A32 G33 K36 L37 R48 N56 G57 R58 K61 M65 K74 R76 K105 R107 K127 L130 G131 K132 K133 G134 V139 R144 T145 R147 G185 R186 R199 H200 G202 F204 R220 K239 R254
BS02	MG	BE	R30 T81	R29 T80

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:0032991 protein-containing complex
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8evp, PDBe:8evp, PDBj:8evp
• PDBsum: 8evp
• PubMed: 37595043
• UniProt: P0CX35|RS4A_YEAST Small ribosomal subunit protein eS4A (Gene Name=RPS4A)