Structure of PDB 6ydp Chain BE

Receptor sequence

>6ydpBE (length=307) Species: 9823 (Sus scrofa)

HGKSVTWWDEHLSEENVPFVKQLVSDENKAQLASKLCPLKDEPWPIHPWE
PGSSRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTPKENHNGR
MAALTVGGKTVSHFHKSASILEFYQELGLPPKQKVKIFNVTENAVIKPGT
PLYAAHFRPGQYVDVTAKTIGKGFQGVMRRWGFKGQPATHGQTKTHRRPG
AISTGDVARVWPGTKMPGQLGNIDRTAFGLKVWRINTKHNIIYVNGSVPG
HKNCLVKIKDSKLPAYKDFCKNLPFPTYFPDGDEEALPEDLYDENVCQPG
APSITFT

3D structure

• PDB: 6ydp Structural insights into mammalian mitochondrial translation elongation catalyzed by mtEFG1.
• Chain: BE
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BE	V46 W48 K62 S66 N69 M106 P108 V118 R141 V152 S153 H156 K157 S158 S160 I161 Y165 V176 K177 I178 T207 T210 I211 G212 K213 G214 F215 G217 R220 R221 W222 F224 K225 Q227 P228 A229 T230 H231 G232 Q233 T234 K235 T236 H237 R238 R239 P240 G241 A242 I243 T245 G246 D247 A249 R250 V251 W252 P253 T255 M257 P258 Q260 L261 G262 N263 I264 D265 R266 T267 F269 G287 S288 V289 P290 G291 H292 K293 N294 K298 K300 K303 P305	V5 W7 K21 S25 N28 M65 P67 V77 R100 V111 S112 H115 K116 S117 S119 I120 Y124 V135 K136 I137 T166 T169 I170 G171 K172 G173 F174 G176 R179 R180 W181 F183 K184 Q186 P187 A188 T189 H190 G191 Q192 T193 K194 T195 H196 R197 R198 P199 G200 A201 I202 T204 G205 D206 A208 R209 V210 W211 P212 T214 M216 P217 Q219 L220 G221 N222 I223 D224 R225 T226 F228 G246 S247 V248 P249 G250 H251 K252 N253 K257 K259 K262 P264

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:6ydp, PDBe:6ydp, PDBj:6ydp
• PDBsum: 6ydp
• PubMed: 32602580
• UniProt: A0A140UHW4