Structure of PDB 4v7h Chain BE

Receptor sequence

>4v7hBE (length=237) Species: 5541 (Thermomyces lanuginosus)

AYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI
ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTL
QRLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVF
GALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGHVSQYMEE
LADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAI

3D structure

• PDB: 4v7h Comprehensive molecular structure of the eukaryotic ribosome.
• Chain: BE
• Resolution: 8.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BE	A11 T18 P19 F20 R21 R22 R24 K27 T28 Y30 R33 T46 P47 K48 Y49 K58 T70 V73 Y79 W95 R112 R152 T154 R158 T187 E189 I190 D214 D215 E216 E217 F223 K224 G225 Y226 L227 A228	A1 T8 P9 F10 R11 R12 R14 K17 T18 Y20 R23 T36 P37 K38 Y39 K48 T60 V63 Y69 W85 R102 R142 T144 R148 T177 E179 I180 D204 D205 E206 E207 F213 K214 G215 Y216 L217 A218
BS02	rna	BE	Y12 S14 R15 F16 R23 Y30 Y31 K34 R35 L36 T38 Q39 K41 K43 E126 G127 E128 Y129 V135 E136 D137 G138 P139 R140 P141 F145 R152 T153 F160 P174 H175 S176 N178 R179 F180	Y2 S4 R5 F6 R13 Y20 Y21 K24 R25 L26 T28 Q29 K31 K33 E116 G117 E118 Y119 V125 E126 D127 G128 P129 R130 P131 F135 R142 T143 F150 P164 H165 S166 N168 R169 F170

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 23 09:08:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v7h', asym_id = 'BE', title = 'Comprehensive molecular structure of the eukaryotic ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v7h', asym_id='BE', title='Comprehensive molecular structure of the eukaryotic ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0008097', uniprot = '', pdbid = '4v7h', asym_id = 'BE'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008097', uniprot='', pdbid='4v7h', asym_id='BE')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>