Structure of PDB 4v6i Chain BE

Receptor sequence

>4v6iBE (length=168) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

MSAKAQNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKA
RYTVRTFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATG
NFGFGIDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGN
SHKTTKEDTVSWFKQKYD

3D structure

PDB

4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.

Chain

Resolution

8.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	BE	T53 R55 I59 R61	T53 R55 I59 R61
BS02	rna	BE	K16 N20 S22 V23 S48 A50 Y52 V54 R55 T56 R94 N95 S97 G105 F123 D126 Y128 V130 R140 K142 R143 T147 V148	K16 N20 S22 V23 S48 A50 Y52 V54 R55 T56 R94 N95 S97 G105 F123 D126 Y128 V130 R140 K142 R143 T147 V148
BS03	rna	BE	M9 Q43 T70 R72 R137 K142	M9 Q43 T70 R72 R137 K142

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v6i, PDBe:4v6i, PDBj:4v6i
PDBsum	4v6i
PubMed	20980660
UniProt	P0C0W9\|RL11A_YEAST Large ribosomal subunit protein uL5A (Gene Name=RPL11A)

[Back to BioLiP]