Structure of PDB 4v62 Chain BE

Receptor sequence
>4v62BE (length=82) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRP
DSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
3D structure
PDB4v62 Cyanobacterial photosystem II at 2.9-A resolution and the role of quinones, lipids, channels and chloride
ChainBE
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide BE I22 L42 I20 L40
BS02 HEM BE R8 F10 I13 R18 Y19 H23 T26 I27 L30 R6 F8 I11 R16 Y17 H21 T24 I25 L28
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v62, PDBe:4v62, PDBj:4v62
PDBsum4v62
PubMed19219048
UniProtQ8DIP0|PSBE_THEVB Cytochrome b559 subunit alpha (Gene Name=psbE)

[Back to BioLiP]