Structure of PDB 8evt Chain BD

Receptor sequence
>8evtBD (length=223) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
ALISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRA
TRTQDVLGENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQA
ESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKF
ADGFLIHSGQPVNDFIDTATRHVLMRQGVLGIKVKIMRDPAKSRTGPKAL
PDAVTIIEPKEEEPILAPSVKDY
3D structure
PDB8evt Regulation of translation by ribosomal RNA pseudouridylation.
ChainBD
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 A BD K141 A145 K139 A143
BS02 U BD R146 A147 R144 A145
BS03 G BD S139 G140 H174 V181 G183 S137 G138 H172 V179 G181
BS04 C BD F156 L157 H159 F154 L155 H157
BS05 G BD I158 H159 I156 H157
BS06 A BD H159 S160 H157 S158
BS07 C BD L4 R9 L2 R7
BS08 U BD A3 I5 A1 I3
BS09 U BD L4 I5 S6 L2 I3 S4
BS10 A BD S6 K7 S4 K5
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Nov 26 04:08:44 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8evt', asym_id = 'BD', title = 'Regulation of translation by ribosomal RNA pseudouridylation.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8evt', asym_id='BD', title='Regulation of translation by ribosomal RNA pseudouridylation.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003723,0003735,0006412,0015935', uniprot = '', pdbid = '8evt', asym_id = 'BD'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0006412,0015935', uniprot='', pdbid='8evt', asym_id='BD')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>