Structure of PDB 7uio Chain BD

Receptor sequence
>7uioBD (length=169) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
AATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRS
QKKHKADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFS
RFRDQETVGAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKI
SDDELERILKELSNLETLY
3D structure
PDB7uio Structural basis of a transcription pre-initiation complex on a divergent promoter.
ChainBD
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide BD G161 I164 Q165 K168 G109 I112 Q113 K116
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0003697 single-stranded DNA binding
GO:0003727 single-stranded RNA binding
GO:0003968 RNA-dependent RNA polymerase activity
GO:0005515 protein binding
GO:0031369 translation initiation factor binding
Biological Process
GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0001172 RNA-templated transcription
GO:0006352 DNA-templated transcription initiation
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006368 transcription elongation by RNA polymerase II
GO:0006397 mRNA processing
GO:0044237 cellular metabolic process
GO:0045948 positive regulation of translational initiation
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0000932 P-body
GO:0005634 nucleus
GO:0005665 RNA polymerase II, core complex
GO:0005737 cytoplasm
GO:0030880 RNA polymerase complex
GO:1990328 RPB4-RPB7 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uio, PDBe:7uio, PDBj:7uio
PDBsum7uio
PubMed36731470
UniProtP20433|RPB4_YEAST DNA-directed RNA polymerase II subunit RPB4 (Gene Name=RPB4)

[Back to BioLiP]