Structure of PDB 7o81 Chain BD

Receptor sequence

>7o81BD (length=294) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

cFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRM
IVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCT
GLLLARRLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLA
RTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMG
QNVADYMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENP
VYEKKPKREVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAA

3D structure

PDB

7o81 Structural basis of ribosomal frameshifting during translation of the SARS-CoV-2 RNA genome.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BD	X2 F3 V4 K5 K8 K10 A11 Y12 K14 R15 Y16 Q17 K19 R23 G26 T28 D29 Y31 R35 L36 K43 Y44 N45 K48 F113 M115 G140 Y145 L146 L150 R152 F160 H175 S176 R179 R268 S272 A274 Q275 D278 R279 Q282 S286 R289 A290	X1 F2 V3 K4 K7 K9 A10 Y11 K13 R14 Y15 Q16 K18 R22 G25 T27 D28 Y30 R34 L35 K42 Y43 N44 K47 F112 M114 G139 Y144 L145 L149 R151 F159 H174 S175 R178 R267 S271 A273 Q274 D277 R278 Q281 S285 R288 A289
BS02	rna	BD	K8 K10 F13 K14 V18 F20 R21 R22 R24 K27 T28 Y30 R33 R50 I52 R54 T56 N57 R58 I61 Q63 I69 D72 M73 I74 N94 Y95 R152 T155 N157 K158 V204 Y207 Q222 S224 Q225 Y226 Y253 K255 K256 R259 V261 K262 K263 R265 W266 N267 R268 P269 K270 M271 L273 K276 R279	K7 K9 F12 K13 V17 F19 R20 R21 R23 K26 T27 Y29 R32 R49 I51 R53 T55 N56 R57 I60 Q62 I68 D71 M72 I73 N93 Y94 R151 T154 N156 K157 V203 Y206 Q221 S223 Q224 Y225 Y252 K254 K255 R258 V260 K261 K262 R264 W265 N266 R267 P268 K269 M270 L272 K275 R278

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7o81, PDBe:7o81, PDBj:7o81
PDBsum	7o81
PubMed	34029205
UniProt	P19949\|RL5_RABIT Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]