Structure of PDB 7nqh Chain BD

Receptor sequence

>7nqhBD (length=210) Species: 9823 (Sus scrofa) [Search protein sequence]

IQVHGIGGGHKQRYRMIDFLRFRPEHESKPGPFEEKVIAVRYDPCRSADI
ALVAGGNRKRWIIATENMKAGDTVLNSDHIGRMAVAAREGDAHPLGALPV
GTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLET
CIATVGRVSNVDHNKRVIGKAGRNRWLGKRPNSGLWQRKGGWAGRKIRPL
PPMKSYVKLP

3D structure

PDB

7nqh Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BD	I91 Q92 V93 I96 H100 K101 Q102 R103 Y104 R105 F109 R131 Y132 P134 R136 L142 K149 R203 Q206 Y207 I208 R209 A210 A211 G212 T213 L229 P230 S231 V251 N254 I258 G259 K260 A261 G262 N264 R265 W266 R270 P271 N272 S273 G274 L275 W276 Q277 R278 K279 G281 W282 A283 G284 R285 K286 R288 Y296	I1 Q2 V3 I6 H10 K11 Q12 R13 Y14 R15 F19 R41 Y42 P44 R46 L52 K59 R113 Q116 Y117 I118 R119 A120 A121 G122 T123 L139 P140 S141 V161 N164 I168 G169 K170 A171 G172 N174 R175 W176 R180 P181 N182 S183 G184 L185 W186 Q187 R188 K189 G191 W192 A193 G194 R195 K196 R198 Y206
BS02	MG	BD	Y132 D133 R136 S137	Y42 D43 R46 S47

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0031090	organelle membrane
GO:0043231	intracellular membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7nqh, PDBe:7nqh, PDBj:7nqh
PDBsum	7nqh
PubMed	33878294
UniProt	F1RRN2

[Back to BioLiP]