Structure of PDB 7ane Chain BD |
>7aneBD (length=97) Species: 5664 (Leishmania major) [Search protein sequence] |
SNRFFQKFYLRCGNCSAIQRSAQGYQPIANPILFKSDEHCRNYHDEQRRA AGYSGMVVTCRCHRCERVHSNWKVLDAQQFLDAKLRMTPEERAQRLW |
|
PDB | 7ane Structure of the mature kinetoplastids mitoribosome and insights into its large subunit biogenesis. |
Chain | BD |
Resolution | 3.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
BD |
C13 C63 |
C12 C62 |
|
|
|
|