Structure of PDB 6q8y Chain BD

Receptor sequence

>6q8yBD (length=220) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEG
LRRARYKFPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLS
KKGSLENNIREFPEYFAAQA

3D structure

PDB

6q8y Structure of the 80S ribosome-Xrn1 nuclease complex.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BD	R2 R3 R6 C7 K12 N13 K14 Y21 D34 K38 S60 E62 A63 R89 H91 F93 R97 S103 D108 M114 R115 G116 A117 W118 G119 Q132 Y156 K157 P159 F172 D192 G193 K197	R2 R3 R6 C7 K12 N13 K14 Y21 D34 K38 S60 E62 A63 R89 H91 F93 R97 S103 D108 M114 R115 G116 A117 W118 G119 Q132 Y156 K157 P159 F172 D192 G193 K197
BS02	rna	BD	Y10 E55 K202 L205	Y10 E55 K202 L205

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6q8y, PDBe:6q8y, PDBj:6q8y
PDBsum	6q8y
PubMed	30911188
UniProt	P41805\|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]