Structure of PDB 6i7o Chain BD

Receptor sequence

>6i7oBD (length=209) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
QGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFPGQ
QKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLENNIRE
FPEYFAAQA

3D structure

PDB

6i7o Collided ribosomes form a unique structural interface to induce Hel2-driven quality control pathways.

Chain

Resolution

5.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BD	R3 R4 A6 R7 K13 N14 Y22 D35 K39 K40 S61 E63 A64 A67 R90 H92 F94 R98 N100 Q113 M115 R116 W119 G120 Q133 R153 R154 Y157 K158 D193 G194 F196 K198	R2 R3 A5 R6 K12 N13 Y21 D34 K38 K39 S60 E62 A63 A66 R89 H91 F93 R97 N99 Q101 M103 R104 W107 G108 Q121 R141 R142 Y145 K146 D181 G182 F184 K186
BS02	rna	BD	E56 S201 K202 K203 G204 S205 L206	E55 S189 K190 K191 G192 S193 L194

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6i7o, PDBe:6i7o, PDBj:6i7o
PDBsum	6i7o
PubMed	30609991
UniProt	P41805\|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]