Structure of PDB 4w29 Chain BD

Receptor sequence

>4w29BD (length=275) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]

AVKKFKPYTPSRRFMTVADFSEITKTEPEKSLVKPLKKTGGRNNQGRITV
RFRGGGHKRLYRIIDFKRWDKVGIPAKVAAIEYDPNRSARIALLHYVDGE
KRYIIAPDGLQVGQQVVAGPDAPIQVGNALPLRFIPVGTVVHAVELEPKK
GAKLARAAGTSAQIQGREGDYVILRLPSGELRKVHGECYATVGAVGNADH
KNIVLGKAGRSRWLGRRPHVRGAAMNPVDHPHGGGEGRAPRGRPPASPWG
WQTKGLKTRKRRKPSSRFIIARRKK

3D structure

PDB

4w29 How the ribosome hands the A-site tRNA to the P site during EF-G-catalyzed translocation.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BD	K4 K7 P8 Y9 T10 R13 R14 V18 F21 L37 K38 K39 R43 N44 N45 Q46 G47 R48 I49 T50 R52 F53 R54 H58 K59 R60 L61 Y62 R63 K68 Y84 N87 R88 H96 V98 D99 G100 E101 K102 L147 E148 P149 K150 K151 K154 L155 A156 R157 A158 A159 G160 T161 Y172 S179 R183 H186 K202 L206 G207 K208 A209 G210 R211 R213 W214 R217 R218 P219 H220 V221 R222 G223 A224 A225 M226 N227 D230 G236 G238 R239 P241 R242 R244 A247 S248 W250 W252 Q253 T254 K255 G256 L257 K258 T259 R260 R263 P265 S266 F269 R274 K275	K3 K6 P7 Y8 T9 R12 R13 V17 F20 L36 K37 K38 R42 N43 N44 Q45 G46 R47 I48 T49 R51 F52 R53 H57 K58 R59 L60 Y61 R62 K67 Y83 N86 R87 H95 V97 D98 G99 E100 K101 L146 E147 P148 K149 K150 K153 L154 A155 R156 A157 A158 G159 T160 Y171 S178 R182 H185 K201 L205 G206 K207 A208 G209 R210 R212 W213 R216 R217 P218 H219 V220 R221 G222 A223 A224 M225 N226 D229 G235 G237 R238 P240 R241 R243 A246 S247 W249 W251 Q252 T253 K254 G255 L256 K257 T258 R259 R262 P264 S265 F268 R273 K274

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4w29, PDBe:4w29, PDBj:4w29
PDBsum	4w29
PubMed	25190797
UniProt	Q72I07\|RL2_THET2 Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]