Structure of PDB 4v8o Chain BD

Receptor sequence

>4v8oBD (length=275) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

AVKKFKPYTPSRRFMTVADFSEITKTEPEKSLVKPLKKTGGRNNQGRITV
RFRGGGHKRLYRIIDFKRWDKVGIPAKVAAIEYDPNRSARIALLHYVDGE
KRYIIAPDGLQVGQQVVAGPDAPIQVGNALPLRFIPVGTVVHAVELEPKK
GAKLARAAGTSAQIQGREGDYVILRLPSGELRKVHGECYATVGAVGNADH
KNIVLGKAGRSRWLGRRPHVRGAAMNPVDHPHGGGEGRAPRGRPPASPWG
WQTKGLKTRKRRKPSSRFIIARRKK

3D structure

PDB

4v8o Crystal Structure of the Hybrid State of Ribosome in Complex with the Guanosine Triphosphatase Release Factor 3.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BD	V138 G139 Q166 G167 R168 I174 N203	V137 G138 Q165 G166 R167 I173 N202
BS02	rna	BD	P8 Y9 T10 R13 F15 V18 F21 K38 K39 G42 R43 N45 G47 R48 I49 T50 V51 R52 R54 G56 H58 K59 L61 Y62 R63 Y84 P86 R88 Y97 V98 D99 G100 E148 P149 K151 K154 L155 A156 R157 A158 A159 G160 L177 S179 E181 A199 H201 K202 L206 G207 K208 A209 G210 R211 S212 R213 W214 R218 P219 H220 V221 R222 A224 A225 M226 P228 D230 H233 G235 G236 E237 G238 R239 P241 R242 R244 P245 P246 S248 W250 W252 Q253 T254 K255 G256 L257 T259 R260 R263 S266 R268 F269 R274	P7 Y8 T9 R12 F14 V17 F20 K37 K38 G41 R42 N44 G46 R47 I48 T49 V50 R51 R53 G55 H57 K58 L60 Y61 R62 Y83 P85 R87 Y96 V97 D98 G99 E147 P148 K150 K153 L154 A155 R156 A157 A158 G159 L176 S178 E180 A198 H200 K201 L205 G206 K207 A208 G209 R210 S211 R212 W213 R217 P218 H219 V220 R221 A223 A224 M225 P227 D229 H232 G234 G235 E236 G237 R238 P240 R241 R243 P244 P245 S247 W249 W251 Q252 T253 K254 G255 L256 T258 R259 R262 S265 R267 F268 R273

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v8o, PDBe:4v8o, PDBj:4v8o
PDBsum	4v8o
PubMed	21903932
UniProt	P60405\|RL2_THET8 Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]