Structure of PDB 4v8k Chain BD

Receptor sequence

>4v8kBD (length=45) Species: 1050 (Thermochromatium tepidum) [Search protein sequence]

LYKIWLILDPRRVLVSIVAFQIVLGLLIHMIVLSTDLNWLDDNIP

3D structure

PDB

4v8k Structure of the LH1-RC complex from Thermochromatium tepidum at 3.0 angstrom

Chain

Resolution

3.006 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CRT	BD	I24 L31 I35 I38	I17 L24 I28 I31
BS02	CRT	BD	L33 H36 M37	L26 H29 M30
BS03	CA	BD	W46 L47 D49 N50 I51	W39 L40 D42 N43 I44
BS04	BCL	BD	Q28 I29 H36 W46	Q21 I22 H29 W39
BS05	BCL	BD	Q28 L31 G32 I35 H36	Q21 L24 G25 I28 H29

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0019866	organelle inner membrane
GO:0030076	light-harvesting complex
GO:0030077	plasma membrane light-harvesting complex

External links