Structure of PDB 4v5g Chain BD

Receptor sequence

>4v5gBD (length=275) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

AVKKFKPYTPSRRFMTVADFSEITKTEPEKSLVKPLKKTGGRNNQGRITV
RFRGGGHKRLYRIIDFKRWDKVGIPAKVAAIEYDPNRSARIALLHYVDGE
KRYIIAPDGLQVGQQVVAGPDAPIQVGNALPLRFIPVGTVVHAVELEPKK
GAKLARAAGTSAQIQGREGDYVILRLPSGELRKVHGECYATVGAVGNADH
KNIVLGKAGRSRWLGRRPHVRGAAMNPVDHPHGGGEGRAPRGRPPASPWG
WQTKGLKTRKRRKPSSRFIIARRKK

3D structure

PDB

4v5g The crystal structure of the ribosome bound to EF-Tu and aminoacyl-tRNA.

Chain

Resolution

3.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BD	K4 K7 P8 Y9 P11 S12 R13 R14 F15 V18 F21 L33 K38 G42 R43 N44 N45 Q46 G47 R48 I49 T50 V51 R52 R54 G56 H58 K59 R60 L61 Y62 R63 I75 K78 Y84 P86 R88 S89 V98 D99 G100 E101 K102 L147 E148 K150 K151 K154 L155 A156 R157 A158 A159 G160 T161 Y172 L177 P178 S179 E181 R183 H186 A199 H201 K202 L206 G207 K208 A209 G210 R211 R213 W214 R218 P219 H220 V221 R222 A224 A225 M226 N227 P228 V229 D230 H231 H233 G235 G236 E237 G238 R239 A240 P241 R242 R244 P246 S248 W250 W252 Q253 T254 K255 G256 K258 T259 R260 K261 R263 K264 S266 R268 F269 R274 K276	K3 K6 P7 Y8 P10 S11 R12 R13 F14 V17 F20 L32 K37 G41 R42 N43 N44 Q45 G46 R47 I48 T49 V50 R51 R53 G55 H57 K58 R59 L60 Y61 R62 I74 K77 Y83 P85 R87 S88 V97 D98 G99 E100 K101 L146 E147 K149 K150 K153 L154 A155 R156 A157 A158 G159 T160 Y171 L176 P177 S178 E180 R182 H185 A198 H200 K201 L205 G206 K207 A208 G209 R210 R212 W213 R217 P218 H219 V220 R221 A223 A224 M225 N226 P227 V228 D229 H230 H232 G234 G235 E236 G237 R238 A239 P240 R241 R243 P245 S247 W249 W251 Q252 T253 K254 G255 K257 T258 R259 K260 R262 K263 S265 R267 F268 R273 K275

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v5g, PDBe:4v5g, PDBj:4v5g
PDBsum	4v5g
PubMed	19833920
UniProt	P60405\|RL2_THET8 Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]