Structure of PDB 4v4y Chain BD

Receptor sequence

>4v4yBD (length=272) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

KFKPYTPSRRFMTVADFSEITKTEPEKSLVKPLKKTGGRNNQGRITVRFR
GGGHKRLYRIIDFKRWDKVGIPAKVAAIEYDPNRSARIALLHYVDGEKRY
IIAPDGLQVGQQVVAGPDAPIQVGNALPLRFIPVGTVVHAVELEPKKGAK
LARAAGTSAQIQGREGDYVILRLPSGELRKVHGECYATVGAVGNADHKNI
VLGKAGRSRWLGRRPHVRGAAMNPVDHPHGGGEGRAPRGRPPASPWGWQT
KGLKTRKRRKPSSRFIIARRKK

3D structure

PDB

4v4y Structural basis for messenger RNA movement on the ribosome.

Chain

Resolution

5.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BD	N203 K276	N199 K272
BS02	rna	BD	R13 F15 M16 V18 A19 I24 K26 K38 K39 G42 R43 N45 Q46 G47 R48 T50 V51 R52 F53 G56 K59 R60 L61 R63 F67 K68 W70 K72 Y84 D85 P86 R88 S89 V98 D99 G100 P149 K150 K151 L155 A156 R157 A158 A159 G160 T161 Y172 L177 P178 S179 R183 H186 N198 A199 K202 L206 K208 A209 G210 R211 R213 W214 L215 R218 H220 V221 R222 G223 A224 M226 N227 D230 H231 H233 G234 G235 E237 G238 R239 A240 P241 R242 R244 P246 A247 S248 P249 W250 W252 Q253 T254 K255 G256 L257 T259 R260 R262 R263 K264 R268	R9 F11 M12 V14 A15 I20 K22 K34 K35 G38 R39 N41 Q42 G43 R44 T46 V47 R48 F49 G52 K55 R56 L57 R59 F63 K64 W66 K68 Y80 D81 P82 R84 S85 V94 D95 G96 P145 K146 K147 L151 A152 R153 A154 A155 G156 T157 Y168 L173 P174 S175 R179 H182 N194 A195 K198 L202 K204 A205 G206 R207 R209 W210 L211 R214 H216 V217 R218 G219 A220 M222 N223 D226 H227 H229 G230 G231 E233 G234 R235 A236 P237 R238 R240 P242 A243 S244 P245 W246 W248 Q249 T250 K251 G252 L253 T255 R256 R258 R259 K260 R264

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v4y, PDBe:4v4y, PDBj:4v4y
PDBsum	4v4y
PubMed	17051149
UniProt	P60405\|RL2_THET8 Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]