Structure of PDB 1vy6 Chain BD

Receptor sequence

>1vy6BD (length=275) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

AVKKFKPYTPSRRFMTVADFSEITKTEPEKSLVKPLKKTGGRNNQGRITV
RFRGGGHKRLYRIIDFKRWDKVGIPAKVAAIEYDPNRSARIALLHYVDGE
KRYIIAPDGLQVGQQVVAGPDAPIQVGNALPLRFIPVGTVVHAVELEPKK
GAKLARAAGTSAQIQGREGDYVILRLPSGELRKVHGECYATVGAVGNADH
KNIVLGKAGRSRWLGRRPHVRGAAMNPVDHPHGGGEGRAPRGRPPASPWG
WQTKGLKTRKRRKPSSRFIIARRKK

3D structure

PDB

1vy6 A proton wire to couple aminoacyl-tRNA accommodation and peptide-bond formation on the ribosome.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	BD	K7 P8 Y9 T10 S12 R13 R14 F15 F21 K31 K35 K38 K39 T40 G42 R43 N44 N45 Q46 G47 R48 I49 T50 V51 R52 R54 G56 H58 K59 R60 L61 Y62 R63 K68 Y84 P86 N87 R88 D99 G100 E101 K102 L147 E148 P149 K151 K154 L155 A156 R157 A158 A159 G160 Y172 L177 P178 S179 E181 R183 A199 H201 K202 L206 G207 K208 A209 G210 R211 R213 W214 R218 P219 H220 V221 R222 G223 A224 A225 M226 P228 V229 D230 H231 H233 G235 G236 E237 G238 R239 A240 P241 R242 G243 R244 P245 P246 A247 S248 P249 W250 W252 Q253 T254 K255 G256 L257 K258 T259 R260 K261 R263 K264 S266 R268 F269 R273 R274	K6 P7 Y8 T9 S11 R12 R13 F14 F20 K30 K34 K37 K38 T39 G41 R42 N43 N44 Q45 G46 R47 I48 T49 V50 R51 R53 G55 H57 K58 R59 L60 Y61 R62 K67 Y83 P85 N86 R87 D98 G99 E100 K101 L146 E147 P148 K150 K153 L154 A155 R156 A157 A158 G159 Y171 L176 P177 S178 E180 R182 A198 H200 K201 L205 G206 K207 A208 G209 R210 R212 W213 R217 P218 H219 V220 R221 G222 A223 A224 M225 P227 V228 D229 H230 H232 G234 G235 E236 G237 R238 A239 P240 R241 G242 R243 P244 P245 A246 S247 P248 W249 W251 Q252 T253 K254 G255 L256 K257 T258 R259 K260 R262 K263 S265 R267 F268 R272 R273
BS02	MG	BD	H220 R222	H219 R221
BS03	MG	BD	F6 R14 F15 M16	F5 R13 F14 M15
BS04	MG	BD	D85 A90 R91	D84 A89 R90
BS05	MG	BD	R60 W214 L215	R59 W213 L214
BS06	MG	BD	V51 R52 R54	V50 R51 R53
BS07	MG	BD	E181 R273 R274	E180 R272 R273

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1vy6, PDBe:1vy6, PDBj:1vy6
PDBsum	1vy6
PubMed	25132179
UniProt	P60405\|RL2_THET8 Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]