Structure of PDB 8a22 Chain BC

Receptor sequence
>8a22BC (length=31) Species: 353565 (Polytomella magna) [Search protein sequence]
ITTMQWRKLKIKKHKLRKRRKANRMRVVKVR
3D structure
PDB8a22 Structure of a mitochondrial ribosome with fragmented rRNA in complex with membrane-targeting elements.
ChainBC
Resolution2.91 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BC M142 R143 V144 M25 R26 V27
BS02 rna BC W123 K129 R148 W6 K12 R31
BS03 rna BC I118 M121 W123 R124 K127 I128 K130 H131 K132 R134 I1 M4 W6 R7 K10 I11 K13 H14 K15 R17
External links