Structure of PDB 7zs5 Chain BC

Receptor sequence

>7zs5BC (length=252) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

GRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDYAERHGYIRGIVKQIVHD
SGRGAPLAKVVFRDPYKYRLREEIFIANEGVHTGQFIYAGKKASLNVGNV
LPLGSVPEGTIVSNVEEKPGDRGALARASGNYVIIIGHNPDENKTRVRLP
SGAKKVISSDARGVIGVIAGGGRVDKPLLKAGRAFHKYRLKRNSWPKTRG
VAMNPVDHPHGGGNHQHIGKASTISRGAVSGQKAGLIAARRTGLLRGSQK
TQ

3D structure

PDB

7zs5 Structural basis for clearing of ribosome collisions by the RQT complex.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BC	G2 R3 N7 Q8 R9 G11 S14 I15 S18 H19 T20 R21 L22 R23 G25 A26 Y34 R37 Y40 I44 H50 R54 R64 Y67 K68 Y69 R70 Y89 A94 S95 E118 K119 A125 L126 A127 R128 A129 S130 G131 N132 L150 P151 S152 K156 G172 G173 R174 K177 L179 L180 K181 A182 G183 F186 H187 K188 R190 L191 K192 R193 N194 W196 P197 K198 T199 R200 G201 V202 M204 N205 V207 D208 H209 H211 G213 G214 N215 H216 Q217 H218 G220 K221 A222 S223 T224 S226 R227 V230 S231 G232 Q233 K234 A235 G236 L237 I238 A239 A240 R241 R242 T243 G244 L245 L246	G1 R2 N6 Q7 R8 G10 S13 I14 S17 H18 T19 R20 L21 R22 G24 A25 Y33 R36 Y39 I43 H49 R53 R63 Y66 K67 Y68 R69 Y88 A93 S94 E117 K118 A124 L125 A126 R127 A128 S129 G130 N131 L149 P150 S151 K155 G171 G172 R173 K176 L178 L179 K180 A181 G182 F185 H186 K187 R189 L190 K191 R192 N193 W195 P196 K197 T198 R199 G200 V201 M203 N204 V206 D207 H208 H210 G212 G213 N214 H215 Q216 H217 G219 K220 A221 S222 T223 S225 R226 V229 S230 G231 Q232 K233 A234 G235 L236 I237 A238 A239 R240 R241 T242 G243 L244 L245

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7zs5, PDBe:7zs5, PDBj:7zs5
PDBsum	7zs5
PubMed	36801861
UniProt	P0CX45\|RL2A_YEAST Large ribosomal subunit protein uL2A (Gene Name=RPL2A)

[Back to BioLiP]