Structure of PDB 7pil Chain BC

Receptor sequence
>7pilBC (length=42) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]
GYTGLTDEQAQELHSVYMSGLWLFSAVAIVAHLAVYIWRPWF
3D structure
PDB7pil Cryo-EM structure of the monomeric Rhodobacter sphaeroides RC-LH1 core complex at 2.5 angstrom.
ChainBC
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SPO BC V22 Y23 G26 L27 V16 Y17 G20 L21
BS02 BCL BC F30 A34 A37 H38 F24 A28 A31 H32
BS03 SPO BC A40 V41 A34 V35
BS04 BCL BC S31 A34 H38 V41 W47 S25 A28 H32 V35 W41
Gene Ontology
Molecular Function
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0016020 membrane
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pil, PDBe:7pil, PDBj:7pil
PDBsum7pil
PubMed34590677
UniProtQ3J1A3|LHB1_CERS4 Light-harvesting protein B-875 beta chain (Gene Name=pufB)

[Back to BioLiP]