Structure of PDB 6yfm Chain BC |
>6yfmBC (length=150) Species: 2027243 (Leviviridae sp.) [Search protein sequence] |
SSQANITVFDGAATPVSHVLVPLGVGIDENLGSVAKWRENLATVPLYANV RVTTMQKKLKSGIERVEIRVEVPVMEAVSGQNAFGYTAAPKVAFTDSGSF VGYFSERSAQSNRRLVKQILTNLLGNVSTSVAAPTTGFASELIDSGITAS |
|
PDB | 6yfm Three-dimensional structure of 22 uncultured ssRNA bacteriophages: Flexibility of the coat protein fold and variations in particle shapes. |
Chain | BC |
Resolution | 2.762 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
BC |
H18 E39 |
H18 E39 |
|
|
|