Structure of PDB 6th6 Chain BC

Receptor sequence

>6th6BC (length=237) Species: 69014 (Thermococcus kodakarensis KOD1)

GKSLIQQRRGKGTTTFRAPSHRYRGAVRYVPLNLVQERTLRGVVEEILHD
PGRTAPVARVKFEDGTKKLIIAPEGVLVGQEIYIGPEAPIAIGNTLPLAK
IPEGTYVYDIEGVPGDGGKYVRAGGTYALVVSREKDKVIVQLPSGELKAF
NPMCRATIGVVAGGGRLEKPIVKAGKAYYIAKARNRFWPKPRGVKMNAVN
HPHGGKEHHIGRPSTVSRRAPPGRKVGHIAARRTGRR

3D structure

• PDB: 6th6 Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.
• Chain: BC
• Resolution: 2.55 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BC	G2 K3 S4 Q7 Q8 R9 R10 G11 K12 T14 T15 T16 S21 H22 R23 A27 R29 H50 R54 K120 Y121 V122 R123 A124 G125 G126 L143 S145 E147 K149 G166 R167 K170 I172 V173 K174 A175 G176 K177 Y180 I181 R187 W189 P190 K191 R193 G194 V195 K196 M197 N198 V200 N201 H204 K207 E208 H209 H210 I211 G212 R213 P214 S215 T216 R219 R220 P222 P223 G228 H229 I230 A232 R233 R234 T235 G236 R237	G1 K2 S3 Q6 Q7 R8 R9 G10 K11 T13 T14 T15 S20 H21 R22 A26 R28 H49 R53 K119 Y120 V121 R122 A123 G124 G125 L142 S144 E146 K148 G165 R166 K169 I171 V172 K173 A174 G175 K176 Y179 I180 R186 W188 P189 K190 R192 G193 V194 K195 M196 N197 V199 N200 H203 K206 E207 H208 H209 I210 G211 R212 P213 S214 T215 R218 R219 P221 P222 G227 H228 I229 A231 R232 R233 T234 G235 R236

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6th6, PDBe:6th6, PDBj:6th6
• PDBsum: 6th6
• PubMed: 32555463
• UniProt: Q5JDH2|RL2_THEKO Large ribosomal subunit protein uL2 (Gene Name=rpl2)