Structure of PDB 6fxc Chain BC

Receptor sequence

>6fxcBC (length=274) Species: 273036 (Staphylococcus aureus RF122) [Search protein sequence]

AIKKYKPITNGRRNMTSLDFAEITKTTPEKSLLKPLPKKAGRNNQGKLTV
RHHGGGHKRQYRVIDFKRNKDGINAKVDSIQYDPNRSANIALVVYADGEK
RYIIAPKGLEVGQIVESGAEADIKVGNALPLQNIPVGTVVHNIELKPGKG
GQIARSAGASAQVLGKEGKYVLIRLRSGEVRMILSTCRATIGQVGNLQHE
LVNVGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAPIGRPSPMSPWG
KPTLGKKTRRGKKSSDKLIVRGRK

3D structure

PDB

6fxc The cryo-EM structure of hibernating 100S ribosome dimer from pathogenic Staphylococcus aureus.

Chain

Resolution

6.76 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BC	L202 R272	L201 R271
BS02	rna	BC	K4 K7 P8 I9 T10 N11 G12 R13 R14 N15 F21 K31 K35 K39 K40 G42 R43 N44 N45 Q46 G47 K48 L49 T50 V51 R52 H54 G55 G56 H58 K59 R60 Q61 Y62 R63 I74 Y83 P85 N86 R87 Y96 A97 D98 G99 E100 K147 G149 K150 Q153 I154 A155 R156 S157 A158 G159 K170 Y171 R177 S178 E180 R182 L198 H200 E201 N204 V205 G206 K207 A208 G209 R210 S211 R212 W213 R217 P218 T219 V220 R221 S223 V224 M225 N226 P227 N228 D229 H232 G234 E236 G237 R238 A239 P240 I241 G242 R243 P244 P246 P249 W250 T254 L255 G256 K257 K258 T259 R260 R261 K263 S266 R274	K3 K6 P7 I8 T9 N10 G11 R12 R13 N14 F20 K30 K34 K38 K39 G41 R42 N43 N44 Q45 G46 K47 L48 T49 V50 R51 H53 G54 G55 H57 K58 R59 Q60 Y61 R62 I73 Y82 P84 N85 R86 Y95 A96 D97 G98 E99 K146 G148 K149 Q152 I153 A154 R155 S156 A157 G158 K169 Y170 R176 S177 E179 R181 L197 H199 E200 N203 V204 G205 K206 A207 G208 R209 S210 R211 W212 R216 P217 T218 V219 R220 S222 V223 M224 N225 P226 N227 D228 H231 G233 E235 G236 R237 A238 P239 I240 G241 R242 P243 P245 P248 W249 T253 L254 G255 K256 K257 T258 R259 R260 K262 S265 R273

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6fxc, PDBe:6fxc, PDBj:6fxc
PDBsum	6fxc
PubMed	28959035
UniProt	Q2YYP9\|RL2_STAAB Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]