Structure of PDB 4v6q Chain BC

Receptor sequence

>4v6qBC (length=234) Species: 2285 (Sulfolobus acidocaldarius)

MAKLTKRMRVIREKVDATKQYDINEAIALLKELATAKFVESVDVAVNLGI
DARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDL
ADQIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVA
EAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAK
PTQAKGVYIKKVSISTTMGAGVAVDQAGLSASVN

3D structure

• PDB: 4v6q Structural characterization of mRNA-tRNA translocation intermediates.
• Chain: BC
• Resolution: 11.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BC	R53 L127 G128	R53 L127 G128
BS02	rna	BC	M1 A2 K3 L4 T5 K6 R7 M8 R12 T18 Q20 A36 K37 S41 D43 R71 R74 K106 G107 E108 N110 V130 L131 G132 P133 R134 R162 R164 D166 K167 N168 I170 H172 T174 Q203 K205 V207 K210 K211 S213 T217 M218 G219 A220 A223	M1 A2 K3 L4 T5 K6 R7 M8 R12 T18 Q20 A36 K37 S41 D43 R71 R74 K106 G107 E108 N110 V130 L131 G132 P133 R134 R162 R164 D166 K167 N168 I170 H172 T174 Q203 K205 V207 K210 K211 S213 T217 M218 G219 A220 A223

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006417 regulation of translation
• GO:0045947 negative regulation of translational initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6q, PDBe:4v6q, PDBj:4v6q
• PDBsum: 4v6q
• PubMed: 22467828
• UniProt: P0A7L0|RL1_ECOLI Large ribosomal subunit protein uL1 (Gene Name=rplA)