Structure of PDB 4v6l Chain BC

Receptor sequence

>4v6lBC (length=234) Species: 83333 (Escherichia coli K-12)

MAKLTKRMRVIREKVDATKQYDINEAIALLKELATAKFVESVDVAVNLGI
DARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDL
ADQIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVA
EAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAK
PTQAKGVYIKKVSISTTMGAGVAVDQAGLSASVN

3D structure

• PDB: 4v6l Structural insights into cognate versus near-cognate discrimination during decoding.
• Chain: BC
• Resolution: 13.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BC	M1 K3 T5 K6 R7 M8 R9 V10 E13 K14 T35 A36 K37 F38 D43 N47 R53 R71 A101 D102 K105 K106 G107 E108 M109 N110 F111 L127 G128 Q129 V130 L131 P133 R134 G135 N139 R162 R164 D166 K167 N168 G169 I170 H172 T174 T217 M218 G219 A220 G221	M1 K3 T5 K6 R7 M8 R9 V10 E13 K14 T35 A36 K37 F38 D43 N47 R53 R71 A101 D102 K105 K106 G107 E108 M109 N110 F111 L127 G128 Q129 V130 L131 P133 R134 G135 N139 R162 R164 D166 K167 N168 G169 I170 H172 T174 T217 M218 G219 A220 G221

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006417 regulation of translation
• GO:0045947 negative regulation of translational initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6l, PDBe:4v6l, PDBj:4v6l
• PDBsum: 4v6l
• PubMed: 21378755
• UniProt: P0A7L0|RL1_ECOLI Large ribosomal subunit protein uL1 (Gene Name=rplA)