Structure of PDB 4v6k Chain BC

Receptor sequence

>4v6kBC (length=393) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

SKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQID
NAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDG
AILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVE
MEVRELLSQYDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIP
EPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVGEEVEIVGIKET
QKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKP
HTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMV
MPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLS

3D structure

PDB

4v6k Structural insights into cognate versus near-cognate discrimination during decoding.

Chain

Resolution

8.25 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	K24 T25 T61 H84
Catalytic site (residue number reindexed from 1)	K24 T25 T61 H84
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	BC	H19 H84 M112	H19 H84 M112
BS02	rna	BC	G222 R223 G224 T256 R279 K282 E284	G222 R223 G224 T256 R279 K282 E284
BS03	rna	BC	A57 R58 D86 Y87 K89 F218 S219 I220 V226 G257 V258 E259 R262 G275 V276 L277 R283 R318 T320 F323 G325 Y326 R327 Q329 T338 I363 R377 E378 G379	A57 R58 D86 Y87 K89 F218 S219 I220 V226 G257 V258 E259 R262 G275 V276 L277 R283 R318 T320 F323 G325 Y326 R327 Q329 T338 I363 R377 E378 G379

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003746	translation elongation factor activity
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0097216	guanosine tetraphosphate binding

	Biological Process
GO:0006412	translation
GO:0006414	translational elongation
GO:0046677	response to antibiotic

	Cellular Component
GO:0005737	cytoplasm
GO:0005886	plasma membrane
GO:0032045	guanyl-nucleotide exchange factor complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v6k, PDBe:4v6k, PDBj:4v6k
PDBsum	4v6k
PubMed	21378755
UniProt	P0CE48\|EFTU2_ECOLI Elongation factor Tu 2 (Gene Name=tufB)

[Back to BioLiP]