Structure of PDB 4v5f Chain BC

Receptor sequence

>4v5fBC (length=228) Species: 300852 (Thermus thermophilus HB8)

PKHGKRYRALLEKVDPNKVYTIDEAARLVKELATAKFDETVEVHAKLGID
PRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEII
QKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIG
EIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHK
PEGAKGTFLRSVYVTTTMGPSVRINPHS

3D structure

• PDB: 4v5f The structure of the ribosome with elongation factor G trapped in the posttranslocational state.
• Chain: BC
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BC	S55 P134 R165	S54 P133 R164
BS02	rna	BC	K3 H4 K6 R7 Y8 A36 K37 F38 T41 E43 H45 K47 P134 R135 D167 K168 T169 H173 P175 G207 S212 Y214 T218 M219 G220 S222	K2 H3 K5 R6 Y7 A35 K36 F37 T40 E42 H44 K46 P133 R134 D166 K167 T168 H172 P174 G206 S211 Y213 T217 M218 G219 S221

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0006417 regulation of translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v5f, PDBe:4v5f, PDBj:4v5f
• PDBsum: 4v5f
• PubMed: 19833919
• UniProt: Q5SLP7|RL1_THET8 Large ribosomal subunit protein uL1 (Gene Name=rplA)