Structure of PDB 4v5e Chain BC

Receptor sequence
>4v5eBC (length=190) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KVYTIDEAARTAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVR
VLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFVMGAVGSKLGRIL
GPRGLNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPE
KLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVR
3D structure
PDB4v5e Insights Into Translational Termination from the Structure of Rf2 Bound to the Ribosome.
ChainBC
Resolution3.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BC D50 R52 R53 D27 R29 R30
BS02 rna BC A35 K36 E42 H44 K46 W107 M108 N165 D166 I171 A173 P174 V175 G176 K177 K205 S211 V214 T215 A12 K13 E19 H21 K23 W84 M85 N132 D133 I138 A140 P141 V142 G143 K144 K172 S178 V181 T182
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v5e, PDBe:4v5e, PDBj:4v5e
PDBsum4v5e
PubMed18988853
UniProtQ5SLP7|RL1_THET8 Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]