Structure of PDB 9eo8 Chain BBB

Receptor sequence

>9eo8BBB (length=117) Species: 9031 (Gallus gallus)

KETAAAKFERQHMDSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAV
CSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHII
VACEGNPYVPVHFDASV

3D structure

• PDB: 9eo8 Picoplatin binding to proteins: X-ray structures and mass spectrometry data on the adducts with lysozyme and ribonuclease A.
• Chain: BBB
• Resolution: 1.76 Å

Enzymatic activity

• Enzyme Commision number: 4.6.1.18: pancreatic ribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NH3	BBB	Q11 H12 K41	Q11 H12 K34
BS02	PT	BBB	E49 D53 M79	E42 D46 M72

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity
• GO:0004522 ribonuclease A activity
• GO:0004540 RNA nuclease activity
• GO:0016829 lyase activity

Biological Process

• GO:0050830 defense response to Gram-positive bacterium

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:9eo8, PDBe:9eo8, PDBj:9eo8
• PDBsum: 9eo8
• PubMed: 38727007
• UniProt: P61824|RNAS1_BISBI Ribonuclease pancreatic (Gene Name=RNASE1)