Structure of PDB 8p8k Chain BBB

Receptor sequence

>8p8kBBB (length=276) Species: 89585 (Lemna aequinoctialis)

TLAQRLRLGSLEPDGLSYKESFIVRSYEVGVNKTATVETIANLLQEVGCN
HAQSVGFSTDGFATTTTMRLLRLIWVTARMHIEIYKYPAWGDVVEIETWC
QEDGKIGTRRDWIIKDYSTGVVIGRATSKWVMMNQDTRRLQRVNDEVREE
YLIFCPRTPRLAFPEEDSDSLKKIPKLEEPAQSSKLGLVPRRADLDMNQH
VNNVTYIGWVLESIPQEIIDTHELQTITLDYRRECQHDDIVDSLSSREGE
CQFLHFLKLSGSGLEINRGRTQWRRL

3D structure

• PDB: 8p8k A Study in Scaffold Hopping: Discovery and Optimization of Thiazolopyridines as Potent Herbicides That Inhibit Acyl-ACP Thioesterase.
• Chain: BBB
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	X7C	BBB	H77 A78 F83 A89 W101 C126 T134 R136 W156 Y177 F180 C181	H51 A52 F57 A63 W75 C100 T108 R110 W130 Y151 F154 C155

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 29 05:55:23 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8p8k', asym_id = 'BBB', title = 'A Study in Scaffold Hopping: Discovery and Optim...t Herbicides That Inhibit Acyl-ACP Thioesterase. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8p8k', asym_id='BBB', title='A Study in Scaffold Hopping: Discovery and Optim...t Herbicides That Inhibit Acyl-ACP Thioesterase. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0006633,0016297,0016790', uniprot = '', pdbid = '8p8k', asym_id = 'BBB'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006633,0016297,0016790', uniprot='', pdbid='8p8k', asym_id='BBB')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>