Structure of PDB 7q9s Chain BBB

Receptor sequence
>7q9sBBB (length=149) Species: 9606 (Homo sapiens) [Search protein sequence]
SAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPK
KILKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNS
TNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRLFYV
3D structure
PDB7q9s Stabilization of the RAS:PDE6D Complex Is a Novel Strategy to Inhibit RAS Signaling.
ChainBBB
Resolution1.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide BBB E88 W90 I109 E110 A111 A112 P113 M117 Y149 E87 W89 I108 E109 A110 A111 P112 M116 Y148
BS02 9TI BBB M20 L22 R61 L63 Q78 F92 W105 M19 L21 R60 L62 Q77 F91 W104
BS03 FAR BBB M20 R61 L63 Q78 I129 M19 R60 L62 Q77 I128
Gene Ontology
Molecular Function
GO:0005095 GTPase inhibitor activity
GO:0005515 protein binding
GO:0031267 small GTPase binding
Biological Process
GO:0007601 visual perception
GO:0050953 sensory perception of light stimulus
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005929 cilium
GO:0016020 membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q9s, PDBe:7q9s, PDBj:7q9s
PDBsum7q9s
PubMed35104933
UniProtO43924|PDE6D_HUMAN Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta (Gene Name=PDE6D)

[Back to BioLiP]