Structure of PDB 7nzf Chain BBB

Receptor sequence
>7nzfBBB (length=177) Species: 9606 (Homo sapiens) [Search protein sequence]
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVT
ELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTV
YPANLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLV
MLETVEVYTCQVEHPSLTSPLTVEWRA
3D structure
PDB7nzf Key interactions in the trimolecular complex consisting of the rheumatoid arthritis-associated DRB1*04:01 molecule, the major glycosylated collagen II peptide and the T-cell receptor.
ChainBBB
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide BBB Y30 P56 D57 Y60 W61 L67 K71 Y78 H81 N82 V85 F89 Y29 P55 D56 Y59 W60 L66 K70 Y77 H80 N81 V84 F88
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 22 20:33:45 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7nzf', asym_id = 'BBB', title = 'Key interactions in the trimolecular complex con...ted collagen II peptide and the T-cell receptor. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7nzf', asym_id='BBB', title='Key interactions in the trimolecular complex con...ted collagen II peptide and the T-cell receptor. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0006955,0016020,0019882,0042613', uniprot = '', pdbid = '7nzf', asym_id = 'BBB'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006955,0016020,0019882,0042613', uniprot='', pdbid='7nzf', asym_id='BBB')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>