Structure of PDB 6t2q Chain BBB

Receptor sequence
>6t2qBBB (length=241) Species: 411901 (Bacteroides caccae ATCC 43185) [Search protein sequence]
NILFVDDFDAKCIVPDTAIWKLCTYANNAWSQYFRGVDGYENVKVEEGYL
KLRACKDNGTYKNGGVFSKIGFPCGTRLEVKARLTKLVRGGFPAIWQMPI
GAPEWPRGGQIDLMEWVQGSPKQIFQTVHTFYINGENGSAGVTNKEADKN
FDVTKDHVYAVQRTEKELIFYVDGKETWKYENQHLDKEKLQYPFCEYPFN
IILNFSLGGELNGMMTWPGEIHDEDLPGEMWVDWVRVVLLD
3D structure
PDB6t2q Prominent members of the human gut microbiota express endo-acting O-glycanases to initiate mucin breakdown.
ChainBBB
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GAL BBB W63 F125 W129 Q143 D145 E148 W30 F92 W96 Q110 D112 E115
BS02 CA BBB D40 G81 D266 D7 G48 D233
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Nov 28 22:40:09 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6t2q', asym_id = 'BBB', title = 'Prominent members of the human gut microbiota ex...-acting O-glycanases to initiate mucin breakdown.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6t2q', asym_id='BBB', title='Prominent members of the human gut microbiota ex...-acting O-glycanases to initiate mucin breakdown.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004553,0005975', uniprot = '', pdbid = '6t2q', asym_id = 'BBB'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004553,0005975', uniprot='', pdbid='6t2q', asym_id='BBB')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>