Structure of PDB 9f1b Chain BB

Receptor sequence

>9f1bBB (length=398) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

SHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKA
GMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRT
FKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDDAGKRQLDKDFS
SMKKYCQVIRVLAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERL
EQQVPVSQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKV
ACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKN
NASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSL
LVQTKRRALEKIDLKFIDTTSKFGHGRFQTVEEKKAFMGPLKKDRIAK

3D structure

PDB

9f1b NAC guides a ribosomal multienzyme complex for nascent protein processing.

Chain

Resolution

3.01 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BB	S2 H3 K5 F6 S7 P9 R10 H11 G12 S13 L14 G15 F16 L17 P18 R19 K20 R21 S23 H25 R26 K28 K30 S31 M53 T54 H55 R62 G64 S65 A75 Y92 T95 P96 R97 L99 R100 T101 F102 K103 T104 F106 R116 R117 F118 Y119 K120 H123 K124 K126 K128 F130 K132 Y133 Y156 R161 R174 Q175 K176 M181 E182 T223 K224 G225 K226 G227 Y228 K229 G230 R234 K238 K239 R242 K243 T244 H245 R246 G247 L248 R249 K250 V251 A252 C253 I254 G255 A256 W257 H258 P259 A260 R261 V262 S265 R268 A269 Q271 Y274 H276 R277 E279 I280 N281 G318 V321 H322 G324 K334 G335 C336 V337 V338 T340 K341 K342 R343 L352 R357 S372 K373 F374 G375 H376 K385 M389 L392 K393 K394 R396	S1 H2 K4 F5 S6 P8 R9 H10 G11 S12 L13 G14 F15 L16 P17 R18 K19 R20 S22 H24 R25 K27 K29 S30 M52 T53 H54 R61 G63 S64 A74 Y91 T94 P95 R96 L98 R99 T100 F101 K102 T103 F105 R115 R116 F117 Y118 K119 H122 K123 K125 K127 F129 K131 Y132 Y155 R160 R173 Q174 K175 M180 E181 T222 K223 G224 K225 G226 Y227 K228 G229 R233 K237 K238 R241 K242 T243 H244 R245 G246 L247 R248 K249 V250 A251 C252 I253 G254 A255 W256 H257 P258 A259 R260 V261 S264 R267 A268 Q270 Y273 H275 R276 E278 I279 N280 G317 V320 H321 G323 K333 G334 C335 V336 V337 T339 K340 K341 R342 L351 R356 S371 K372 F373 G374 H375 K384 M388 L391 K392 K393 R395

External links

PDB	RCSB:9f1b, PDBe:9f1b, PDBj:9f1b
PDBsum	9f1b
PubMed	39169182
UniProt	G1TL06\|RL3_RABIT Large ribosomal subunit protein uL3 (Gene Name=RPL3)

[Back to BioLiP]