Structure of PDB 8evt Chain BB

Receptor sequence

>8evtBB (length=214) Species: 4932 (Saccharomyces cerevisiae)

VVDPFTRKEWFDIKAPSTFENRNVGKTLVNKSTGLKSASDALKGRVVEVC
LADLQGSEDHSFRKIKLRVDEVQGKNLLTNFHGMDFTTDKLRSMVRKWQT
LIEANVTVKTSDDYVLRIFAIAFTRKQANQVKRHSYAQSSHIRAIRKVIS
EILTKEVQGSTLAQLTSKLIPEVINKEIENATKDIFPLQNIHVRKVKLLK
QPKFDVGALMALHG

3D structure

• PDB: 8evt Regulation of translation by ribosomal RNA pseudouridylation.
• Chain: BB
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BB	P23 R26 K27 K55 R111 V114 K116 W117 Q118 N124 R136 F138 Q146 N148 Q149 V150 K151 H153 Y155 Q157 S158 S159 H160 R165 K202 D203 I204 F205 P206 K214 K216	P4 R7 K8 K36 R92 V95 K97 W98 Q99 N105 R117 F119 Q127 N129 Q130 V131 K132 H134 Y136 Q138 S139 S140 H141 R146 K183 D184 I185 F186 P187 K195 K197
BS02	U	BB	K116 W117 R152	K97 W98 R133

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Dec 12 10:54:23 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8evt', asym_id = 'BB', title = 'Regulation of translation by ribosomal RNA pseudouridylation.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8evt', asym_id='BB', title='Regulation of translation by ribosomal RNA pseudouridylation.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '8evt', asym_id = 'BB'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='8evt', asym_id='BB')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>