Structure of PDB 7pil Chain BB

Receptor sequence
>7pilBB (length=43) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]
LGYTGLTDEQAQELHSVYMSGLWLFSAVAIVAHLAVYIWRPWF
3D structure
PDB7pil Cryo-EM structure of the monomeric Rhodobacter sphaeroides RC-LH1 core complex at 2.5 angstrom.
ChainBB
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SPO BB L19 V22 G26 L27 L14 V17 G21 L22
BS02 BCL BB V33 A34 A37 H38 V41 V28 A29 A32 H33 V36
BS03 SPO BB A40 V41 I43 A35 V36 I38
BS04 BCL BB Y23 F48 Y18 F43
BS05 BCL BB F30 H38 V41 W47 F25 H33 V36 W42
Gene Ontology
Molecular Function
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0016020 membrane
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pil, PDBe:7pil, PDBj:7pil
PDBsum7pil
PubMed34590677
UniProtQ3J1A3|LHB1_CERS4 Light-harvesting protein B-875 beta chain (Gene Name=pufB)

[Back to BioLiP]